Home > Product > Catalog Peptides > Others > Virescein

Others

CAT#
M16003
Sequence
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH
Modifications
Histidine amide
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.