Home > Product > Antimicrobial Peptides > Viscotoxin A2

Antimicrobial Peptides

Viscotoxin A2

Price Inquiry
CAT#
AF3204
Sequence
KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK
Host Chemicals
Viscum album L
Length
46
Activity
Cancer cells
SwissProt ID
PDB ID: 1JMN

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.