Home > Product > Antimicrobial Peptides > Viscotoxin 1-PS

Antimicrobial Peptides

Viscotoxin 1-PS

[Price Inquiry]
CAT#
AF3203
Sequence
KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK
Host Chemicals
Viscum album L
Length
46
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.