CAT# | AF3213 |
Sequence | RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC |
Activity | Insects, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...