Home > Product > Antimicrobial Peptides > VrCRP

Antimicrobial Peptides

CAT#
AF3213
Sequence
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
Host Chemicals
a bruchid-resistant mungbean, V. radiata
Length
46
Activity
Insects,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.