Antimicrobial Peptides

CAT#
AF3214
Sequence
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
Host Chemicals
seeds, Vigna radiata
Length
46
Activity
Fungi, Insects,
SwissProt ID
PDB ID: 1TI5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.