Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3214
Sequence
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
Host Chemicals
seeds, Vigna radiata
Length
46
Activity
Fungi, Insects,
SwissProt ID
PDB ID: 1TI5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.