Antimicrobial Peptides

CAT#
AF3223
Sequence
KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
Host Chemicals
Vigna radiata
Length
47
Activity
Gram+ & Gram-, Fungi,
SwissProt ID
PDB ID: 2GL1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.