Home > Product > Catalog Peptides > Others > w-Agatoxin-TK

Others

w-Agatoxin-TK

[Price Inquiry]
CAT#
C27008
Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
M.W/Mr.
5273.1
Molecular Formula
C215H337N65O70S10
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.