Antimicrobial Peptides

CAT#
AF2508
Sequence
KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG
Host Chemicals
Macropus eugenii
Length
36
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.