Home > Product > Antimicrobial Peptides > WAMP-1a

Antimicrobial Peptides

CAT#
AF3056
Sequence
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Host Chemicals
Triticum kiharae
Length
44
Activity
Antifungal
SwissProt ID
P85966
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.