Keywords Search Google Search Search

WAMP-1b

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3130
Sequence	AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR
Activity	Antifungal

CAT#	Product Name	Inquiry
AF941	Nigrocin-2ISa	Inquiry
AF2973	Antihypertensive protein BDS-1	Inquiry
AF1360	Brevinin-1-OR5	Inquiry
AF1900	Brevinin-2Ej	Inquiry
AF472	Beta-basrubin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Anticancer Function of Topotecan Hydrochloride

Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Function of Hexanoyl Dipeptide-3 Norleucine Acetate in Human Skin

Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Triticum kiharae
Length	45