Home > Product > Antimicrobial Peptides > WAMP-1b

Antimicrobial Peptides

CAT#
AF3130
Sequence
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR
Host Chemicals
Triticum kiharae
Length
45
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.