Home > Product > Antimicrobial Peptides > WAMP-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2761
Sequence
CGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCR
Host Chemicals
Triticum kiharae
Length
39
Activity
Antimicrobial
SwissProt ID
H6S4F1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.