Home > Product > Catalog Peptides > Others > 2 X tandem repeats of SVP-1 like motif

Others

2 X tandem repeats of SVP-1 like motif

[Price Inquiry]
CAT#
S15012
Sequence
VKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.