Adrenomedullin (AM) (13-52), human
Adrenomedullin (AM) (13-52), human
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
Online Inquiry
| CAT# | R1172 |
| CAS | 154765-05-6 |
| M.F/Formula | C₂₀₀H₃₀₈N₅₈O₅₉S₂ |
| M.W/Mr. | 4533.10 |
| Sequence | One Letter Code: SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
three Letter Code: Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) |
Write a review
Ask a question
My Review for Adrenomedullin (AM) (13-52), human
Required fields are marked with *
×
Ask a Question for Adrenomedullin (AM) (13-52), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
