Adrenomedullin (1-52), human

Adrenomedullin(1-52) is a 52-amino acid peptide with multi-functions. It was originally isolated from pheochromocytoma and adrenal medulla but is widely distributed throughout the body including lung and kidney tissues. Besides controlling fluid-electrolyte homeostasis, adrenomedullin is a potent vasodilator and can inhibit pituitary ACTH secretion.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1864
CAS	148498-78-6
Synonyms/Alias	Human adrenomedullin; Adrenomedullin (human); Human adrenomedullin-(1-52)-NH2
M.F/Formula	C264H406N80O77S3
M.W/Mr.	6029
Sequence	One Letter Code: YRQSMNNFQGIRSFGC1RFGTC1TVQKLAHQITQFTDKDKDNVAPRSKISPQGY Three Letter Code: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Ile-Arg-Ser-Phe-Gly-Cys(1)-Arg-Phe-Gly-Thr-Cys(1)-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Appearance	White or off-white lyophilized powder
Purity	> 95%

CAT#	Product Name	Inquiry
R1206	Antennapedia Peptide	Inquiry
R1980	DiaPep277	Inquiry
R2064	Glepaglutide	Inquiry
PI-001	GIP (1-39)	Inquiry
R1060	GaTx2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Length	42
Storage	Store at -20°C.
Solubility	Soluble in water
Shipping Condition	+20°C (International: -20°C)
InChI Key	ULCUCJFASIJEOE-NPECTJMMSA-N