CAT# | A05012 |
M.F/Formula | C159H252N46O48 |
M.W/Mr. | 3576.1 |
Sequence | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...