Home > Product > Catalog Peptides > Amylins (IAPP) and Fragments > Amylin (8-37), rat

Amylins (IAPP) and Fragments

Amylin (8-37), rat

Price Inquiry
CAT#
A12010
Sequence
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
M.W/Mr.
3200.6
Molecular Formula
C140H227N43O43
Length
30

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.