CAT# | R1077 |
CAS | 252642-12-9 |
M.F/Formula | C184H297N69O43S |
M.W/Mr. | 4195.87 |
Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...