Keywords Search Google Search Search

Beta-defensin 5

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2519
Sequence	NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2806	Def-Aaa From The Insect Anopheles Gambiae	Inquiry
AF2434	Defensin-related cryptdin-15	Inquiry
AF573	Antimicrobial peptide , immobilized peptide E17HSA magainin 2 deletion	Inquiry
AF2557	Putative antimicrobial peptide A Northern Europe Heligoland variant	Inquiry
AF3345	Human Platelet Factor IV 18, C18G	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

UFP-101-A Peptide Antagonist Selective for the Nociceptin/Orphanin FQ Receptor

Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

Jingzhaotoxin-III, A Selective NaV1.5 Channel Blocker

Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...

Enhanced Binding and Antagonism of Camstatin

Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Bos taurus
Length	36
SwissProt ID	P46163