Home > Product > Antimicrobial Peptides > Big defensin 3

Antimicrobial Peptides

Big defensin 3

Price Inquiry
CAT#
AF3113
Sequence
QAQILLPIASYAGLTVTAPVFAALVAAYGIYAVTRYAIRKRRIV
Host Chemicals
Crassostrea gigas
Length
44
Activity
Antimicrobial
SwissProt ID
F6M2J1

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.