Brain Natriuretic Peptide (BNP) (1-32), rat

Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1251
CAS	133448-20-1
Synonyms/Alias	Brain Natriuretic Peptide-32 (rat)
M.F/Formula	C₁₄₆H₂₃₉N₄₇O₄₄S₃
M.W/Mr.	3452.94
Sequence	One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) three Letter Code: Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)

CAT#	Product Name	Inquiry
R0888	Decanoyl-Arg-Val-Lys-Arg-chloromethylketone	Inquiry
R1201	Angiotensin II (3-8), human	Inquiry
R1327	D-Lys(Z)-Pro-Arg-pNA diacetate	Inquiry
R1997	Pirnabine	Inquiry
R1599	Pancreatic Polypeptide, bovine	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Storage	-20 ± 5 °C