BNP-45 rat
BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic and
hypotensive activities.
Online Inquiry
| CAT# | R1240 |
| CAS | 123337-89-3 |
| Synonyms/Alias | Brain natriuretic peptide-45 rat |
| M.F/Formula | C₂₁₃H₃₄₉N₇₁O₆₅S₃ |
| M.W/Mr. | 5040.67 |
| Sequence | One Letter Code: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39)
three Letter Code: Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for BNP-45 rat
Required fields are marked with *
×
Ask a Question for BNP-45 rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
