C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
CAT# | R1312 |
CAS | 141294-77-1 |
Synonyms/Alias | CNP-53 (human) |
M.F/Formula | C₂₅₁H₄₁₇N₈₁O₇₁S₃ |
M.W/Mr. | 5801.77 |
Sequence | One Letter Code: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC three Letter Code: Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...