Cecropin B is an antibacterial peptide isolated from pig intestine and moths. This peptide inhibits proline uptake in bacteria by lysing cell membranes and making them leaky.
CAT# | R1863 |
CAS | 80451-05-4 |
M.F/Formula | C176H302N52O41S |
M.W/Mr. | 3835 |
Sequence | One Letter Code: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Three Letter Code: H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
Purity | ≥97% (HPLC) |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...