Cecropin B is an antibacterial peptide isolated from pig intestine and moths. This peptide inhibits proline uptake in bacteria by lysing cell membranes and making them leaky.
CAT# | R1863 |
CAS | 80451-05-4 |
M.F/Formula | C176H302N52O41S |
M.W/Mr. | 3835 |
Sequence | One Letter Code: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Three Letter Code: H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
Purity | ≥97% (HPLC) |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...