Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain
CAT# | R1862 |
CAS | 101462-82-2 |
Synonyms/Alias | Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human |
M.F/Formula | C162H267N51O48S3 |
M.W/Mr. | 3793.41 |
Sequence | One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 |
Application | Neuropeptide |
Appearance | White or off-white lyophilized powder |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...