Keywords Search Google Search Search

CRF, bovine

CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1306
CAS	92307-52-3
Synonyms/Alias	Corticotropin Releasing Factor bovine
M.F/Formula	C₂₀₆H₃₄₀N₆₀O₆₃S
M.W/Mr.	4697.34
Sequence	One Letter Code: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 three Letter Code: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

CAT#	Product Name	Inquiry
R1258	Caerulein, desulfated	Inquiry
R0960	[Glu27]-PKC (19-36)	Inquiry
R1928	Gp100 (25-33), mouse	Inquiry
R1695	Substance P, Free Acid	Inquiry
R1708	TAT 48-57	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Linear Heptapeptide Antagonist, GR 94800

GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Palmitoyl Tripeptide-1

Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...

Function of peptide YY (3-36) in ingestion behavior

Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: