Various Products/Alzheimer's Disease

Galanin, human

Price Inquiry
CAT#
G01014
Sequence
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
M.W/Mr.
3157.5
Molecular Formula
C139H210N42O43
Length
30

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.