Glucagon-like peptide 1 (1-37), human
Glucagon-like peptide 1 (1-37), human
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Online Inquiry
| CAT# | R1386 |
| CAS | 87805-34-3 |
| Synonyms/Alias | HuGLP-1 |
| M.F/Formula | C₁₈₆H₂₇₅N₅₁O₅₉ |
| M.W/Mr. | 4169.48 |
| Sequence | One Letter Code: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
three Letter Code: His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
Write a review
Ask a question
My Review for Glucagon-like peptide 1 (1-37), human
Required fields are marked with *
×
Ask a Question for Glucagon-like peptide 1 (1-37), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
