Keywords Search Google Search Search

HFIAP-1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2574
Sequence	GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
Activity	Gram+ & Gram-,

CAT#	Product Name	Inquiry
AF2359	Neutrophil antibiotic peptide NP-3B	Inquiry
AF479	Protegrin-2	Inquiry
AF087	Non-disulfide-bridged peptide 57	Inquiry
AF1569	Pleurain-a2	Inquiry
AF2760	Preprodamicornin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Clinical efficacy of antazoline in rapid cardioversion of paroxysmal atrial fibrillation

Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...

Function of D15 As An Endocytosis Inhibitor

The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Atlantic hagfish, Myxine glutinosa
Length	37