Home > Product > Catalog Peptides > Others > Histidine-rich basic peptide

Others

Histidine-rich basic peptide

Price Inquiry
CAT#
A27018
Sequence
QVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
Modifications
Pyrrolidone carboxylic acid
Length
43

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.