Keywords Search Google Search Search

Lichenicidin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2157
Sequence	TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF857	Palustrin-RA peptide precursor	Inquiry
AF745	Ranacyclin-B-RN2	Inquiry
AF3079	ENAP-1	Inquiry
AF287	Ll-37-Derived Aurein 1.2 Analog	Inquiry
AF241	OdG1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Clinical efficacy of antazoline in rapid cardioversion of paroxysmal atrial fibrillation

Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...

Potent blocker of voltage-gated sodium channels-Phrixotoxin 3

The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of lepirudin in heparin-induced thrombocytopenia

Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: