Home > Product > Antimicrobial Peptides > Lingual antimicrobial peptide

Antimicrobial Peptides

Lingual antimicrobial peptide

Price Inquiry
CAT#
AF2520
Sequence
NPVSCARNKGICVPSRCPGNMRQIGTCLGPPVKCCR
Host Chemicals
Bubalus bubalis
Length
36
Activity
Antimicrobial
SwissProt ID
Q1PAH7

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.