Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2

Antimicrobial Peptides

Liver-expressed antimicrobial peptide 2

Price Inquiry
CAT#
AF2911
Sequence
RRVARMTPLWRIMSSKPFGAYCQNNYECSTGLCRAGHCSTS
Host Chemicals
Paralichthys olivaceus
Length
41
Activity
Antimicrobial
SwissProt ID
B2LUN1

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.