Home > Product > Antimicrobial Peptides > Odorranain-A-RA1 peptide precursor

Antimicrobial Peptides

Odorranain-A-RA1 peptide precursor

Price Inquiry
CAT#
AF2850
Sequence
PMKKSLLLLFFFGTISLSLCQQERDADEEEGSENGAEDIK
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
40
Activity
Antimicrobial
SwissProt ID
E3SZA0

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.