Pancreatic Polypeptide, human

Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1600
CAS	75976-10-2
Synonyms/Alias	Human pancreatic polypeptide
M.F/Formula	C₁₈₅H₂₈₇N₅₃O₅₄S₂
M.W/Mr.	4181.71
Sequence	One Letter Code: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 three Letter Code: Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

CAT#	Product Name	Inquiry
R1003	[Orn5]-URP	Inquiry
R1402	GroES mobile loop	Inquiry
HB00049	Fitc-VDVAD-FMK	Inquiry
R1780	β-Amyloid 18-28	Inquiry
R2052	Zilucoplan	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.