Keywords Search Google Search Search

Pediocin PA-1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2475
Sequence	YYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATG
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2612	Oxyopinin-2d	Inquiry
AF2977	Big defensin 3	Inquiry
AF331	Polybia-MPI	Inquiry
AF3286	Rs-AFP4	Inquiry
AF2188	Brevinin-2-RA21 antimicrobial peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Inhibitors of Aspartic Proteases-Acetyl Pepstatin

Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...

Function of Huwentoxin-XVI in analgesia

Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Anticancer Function of Topotecan Hydrochloride

Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Synthetic construct
Length	35