Home > Product > Catalog Peptides > Others > Prepro VIP (81-122), human

Others

Prepro VIP (81-122), human

Price Inquiry
CAT#
V02021
Sequence
ADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
M.W/Mr.
4552.2
Molecular Formula
C202H325N53O64S1
Length
41

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.