Urotensin I
Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.
Online Inquiry
| CAT# | R1742 |
| CAS | 83930-33-0 |
| Synonyms/Alias | Catostomus urotensin I |
| M.F/Formula | C₂₁₀H₃₄₀N₆₂O₆₇S₂ |
| M.W/Mr. | 4869.46 |
| Sequence | One Letter Code: NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
three Letter Code: Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 |
| Source# | Synthetic |
Length | 41 |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Urotensin I
Required fields are marked with *
×
Ask a Question for Urotensin I
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
