Home > Product > Antimicrobial Peptides > 2S albumin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

2S albumin

[Price Inquiry]
CAT#
AF3112
Sequence
PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC
Host Chemicals
Taraxacum officinale
Length
44
Activity
Antimicrobial
SwissProt ID
P86783
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.