CAT# | AF3112 |
Sequence | PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC |
Activity | Antimicrobial |
Host Chemicals | Taraxacum officinale | Length | 44 | SwissProt ID | P86783 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF957 | Nigrocin-1-OR3 | Inquiry | ||
AF2363 | Sarcotoxin Pd | Inquiry | ||
AF2815 | Phormia defensin A | Inquiry | ||
AF2808 | AalDefD | Inquiry | ||
AF652 | 30 kDa antifungal protein | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...