Home > Product > Antimicrobial Peptides > Abaecin precursor

Antimicrobial Peptides

Abaecin precursor

[Price Inquiry]
CAT#
AF2401
Sequence
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
Host Chemicals
Apis mellifera
Length
34
Activity
Antibacterial
SwissProt ID
P15450
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.