Keywords Search Google Search Search

Acrorhagin-1a

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A29003
Sequence	SLTPSSDIPWEKCRHDCFAKYMSCQMSDSCHNKPSCRQCQVTYAICVSTGCP

CAT#	Product Name	Inquiry
X07189	PM_15598577_2	Inquiry
X09753	PM_18996355	Inquiry
X06398	PM_14678783	Inquiry
X01729	PH1PO087_23	Inquiry
X08840	PM_17465004	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

Function of Hexanoyl Dipeptide-3 Norleucine Acetate in Human Skin

Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...

APETx2, A Kind of ASIC3 Channel Blocker

APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Function of Urantide in the Rat Aorta

Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: