Home > Product > Catalog Peptides > Others > ACTH (1-39) (mouse, rat)

Others

ACTH (1-39) (mouse, rat)

[Price Inquiry]
CAT#
A03023
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
M.W/Mr.
4582.23
Molecular Formula
C210H315N57O57S
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.