CAT# | A03023 |
M.F/Formula | C210H315N57O57S |
M.W/Mr. | 4582.23 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...