Home > Product > Catalog Peptides > Others > ACTH (1-39) (mouse, rat)

Others

ACTH (1-39) (mouse, rat)

Price Inquiry
CAT#
A03023
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
M.W/Mr.
4582.23
Molecular Formula
C210H315N57O57S
Length
39

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.