Home > Product > Catalog Peptides > Others > Adrenomedullin (1-52), human

Others

Adrenomedullin (1-52), human

[Price Inquiry]
CAT#
A05004
Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA
M.W/Mr.
6028.8
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.