Home > Product > Catalog Peptides > Others > Adrenomedullin (1-50), rat

Others

Adrenomedullin (1-50), rat

[Price Inquiry]
CAT#
A05006
Sequence
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPR
M.W/Mr.
5729.5
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.