AmmTX3

AamTx3 is a blocker of KV4 channel, which blocks A-type K+ current (ISA) in mouse cerebellar granule neurons.

Online Inquiry

CAT#R0861
M.F/FormulaC158H262N50O48S6
M.W/Mr.3822.47
SequenceXIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)
Labeling TargetKV4 K+ channels
ApplicationBy blocking specifically the Kv4 channels, AmmTX3 reduces the A-type potassium current through these channels almost completely.
Purity>98 %
ActivityBlocker
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

 Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...

of skin aging  Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

 Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...

 Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.