Home > Product > Catalog Peptides > Others > Amylin (1-37), human, amide

Others

warning All products are for research use only. Not for human use.

Amylin (1-37), human, amide

[Price Inquiry]
CAT#
A12013
Sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
M.W/Mr.
3903.3
Modifications
disulfide
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.