CAT# | A12013 |
M.W/Mr. | 3903.3 |
Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
Length | 37 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A12020 | Amylin (20-29) (human) | Inquiry | ||
A12009 | Amylin (8-37), human | Inquiry | ||
A12003 | Amylin(20-29), Islet Amyloid Polypeptide, IAPP (20-29), cat | Inquiry | ||
A12017 | Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide | Inquiry | ||
CAD-108 | Biotinyl-Amylin (human) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...