Home > Product > Catalog Peptides > Amylins (IAPP) and Fragments > Amylin (1-37), human, amide

Amylins (IAPP) and Fragments

Amylin (1-37), human, amide

Price Inquiry
CAT#
A12013
Sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
M.W/Mr.
3903.3
Modifications
disulfide
Length
37

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.