Angiotensin II (1-4), human

Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca2+ levels. Angiotensin II also acts at the Na+/H+ exchanger in the proximal tubules of the kidney.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1200
CAS	52580-29-7
M.F/Formula	C₂₄H₃₇N₇O₈
M.W/Mr.	551.59
Sequence	One Letter Code: DRVY 姃three Letter Code: Asp-Arg-Val-Tyr

CAT#	Product Name	Inquiry
R1795	β-CGRP, human TFA	Inquiry
R1087	R 715	Inquiry
R1181	Allergen Gal d 4 (46-61), chicken	Inquiry
R2058	Aspartame	Inquiry
R1365	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.