Home > Product > Catalog Peptides > Others > Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide

Others

warning All products are for research use only. Not for human use.

Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide

[Price Inquiry]
CAT#
C08026
Sequence
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
M.W/Mr.
4404.3
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.