Home > Product > Antimicrobial Peptides > Antifungal protein S

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antifungal protein S

[Price Inquiry]
CAT#
AF2561
Sequence
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP
Host Chemicals
Hordeum vulgare
Length
37
Activity
Antifungal
SwissProt ID
P33045
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.