Home > Product > Antimicrobial Peptides > Antimicrobial peptide Def1-2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial peptide Def1-2

[Price Inquiry]
CAT#
AF2283
Sequence
SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR
Host Chemicals
Nasonia vitripennis
Length
33
Activity
Antimicrobial
SwissProt ID
D0EZK5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.